DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14301 and CG14304

DIOPT Version :10

Sequence 1:NP_650734.2 Gene:CG14301 / 42235 FlyBaseID:FBgn0038632 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_650731.3 Gene:CG14304 / 42232 FlyBaseID:FBgn0038629 Length:1136 Species:Drosophila melanogaster


Alignment Length:147 Identity:64/147 - (43%)
Similarity:85/147 - (57%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DENGSQEKDL---PEIPDNFLSPSVREYLELGKSIPGRPGVDYPILSAVPYTNFYCDEQEYPGFF 113
            :|:.||.::.   |:.|:....||.           ||||:|||..:.:|.|:|.|.:|.|.|||
  Fly   819 EEHHSQSEEAIARPKGPNKHPGPST-----------GRPGIDYPNYAEIPQTSFECTKQRYKGFF 872

  Fly   114 ADMETRCQGWHYCDIDGRQATFLCPNGTQFSQAVFVCDWWFNVRCDLSPRLYAINARLYQ----- 173
            .|.||.||.|||||::|.:|:|||||||.|||....|||||||:|..:.:||.:|.|||:     
  Fly   873 GDPETNCQVWHYCDLNGGKASFLCPNGTIFSQIALTCDWWFNVKCSTTAQLYVLNERLYKYILPF 937

  Fly   174 RPKVNPTRPHRIITKQL 190
            .||........|:.|.|
  Fly   938 NPKFPEDYNGPIVDKYL 954

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14301NP_650734.2 CBM_14 104..156 CDD:426342 33/51 (65%)
CG14304NP_650731.3 PAT1 <524..>682 CDD:401645
PHA03247 <605..802 CDD:223021
CBM_14 863..917 CDD:426342 35/53 (66%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.