DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14301 and CG14304

DIOPT Version :9

Sequence 1:NP_650734.2 Gene:CG14301 / 42235 FlyBaseID:FBgn0038632 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001138080.1 Gene:CG14304 / 42232 FlyBaseID:FBgn0038629 Length:1136 Species:Drosophila melanogaster


Alignment Length:147 Identity:64/147 - (43%)
Similarity:85/147 - (57%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DENGSQEKDL---PEIPDNFLSPSVREYLELGKSIPGRPGVDYPILSAVPYTNFYCDEQEYPGFF 113
            :|:.||.::.   |:.|:....||.           ||||:|||..:.:|.|:|.|.:|.|.|||
  Fly   819 EEHHSQSEEAIARPKGPNKHPGPST-----------GRPGIDYPNYAEIPQTSFECTKQRYKGFF 872

  Fly   114 ADMETRCQGWHYCDIDGRQATFLCPNGTQFSQAVFVCDWWFNVRCDLSPRLYAINARLYQ----- 173
            .|.||.||.|||||::|.:|:|||||||.|||....|||||||:|..:.:||.:|.|||:     
  Fly   873 GDPETNCQVWHYCDLNGGKASFLCPNGTIFSQIALTCDWWFNVKCSTTAQLYVLNERLYKYILPF 937

  Fly   174 RPKVNPTRPHRIITKQL 190
            .||........|:.|.|
  Fly   938 NPKFPEDYNGPIVDKYL 954

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14301NP_650734.2 CBM_14 104..156 CDD:279884 33/51 (65%)
CG14304NP_001138080.1 CBM_14 863..917 CDD:279884 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AA9A
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101965at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.