DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14301 and CG32036

DIOPT Version :9

Sequence 1:NP_650734.2 Gene:CG14301 / 42235 FlyBaseID:FBgn0038632 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster


Alignment Length:147 Identity:56/147 - (38%)
Similarity:79/147 - (53%) Gaps:33/147 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PEPQQDLENDENGSQEKDLPEIPDNFLSPSVREYLELGKSIPGRPGVDYPILSAVPYTNFYC-DE 106
            |:|    |:.::..:::||                   ..|||.|||||||...||:|:|.| :.
  Fly    34 PQP----EHPQHHEKKQDL-------------------NKIPGVPGVDYPIYHEVPHTHFSCHNV 75

  Fly   107 QEYPGFFADMETRCQGWHYCDIDGRQ----ATFLCPNGTQFSQAVFVCDWWFNVRCDLSPRLYAI 167
            ...||.:|::||.||.:|.|. |||:    |.|||.|||.|:|..|.||||:||:|:.:...|.:
  Fly    76 PATPGMYANVETGCQAYHVCH-DGREGDQGAKFLCTNGTIFNQKEFACDWWYNVKCEEATHFYHL 139

  Fly   168 NARLYQRPKVNPTRPHR 184
            ||    .|:.||..|.:
  Fly   140 NA----DPEHNPYIPKK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14301NP_650734.2 CBM_14 104..156 CDD:279884 27/56 (48%)
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.