DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and NPR1

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_014216.1 Gene:NPR1 / 855538 SGDID:S000005127 Length:790 Species:Saccharomyces cerevisiae


Alignment Length:369 Identity:90/369 - (24%)
Similarity:144/369 - (39%) Gaps:93/369 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GTRSSDVDALAQRGYNVGH-KIGEGSYATVITAGYAD---DHGHG-------------------- 54
            |:..|...|:....::..| ..|..||:|... |..|   .|.||                    
Yeast   384 GSPLSSGIAVPSHSHSSSHFAAGNNSYSTSYN-GNGDTIYSHSHGGSGIPFSKRYIKTGADLGAG 447

  Fly    55 ----VHLACKIID-KAKAPTDFVNKF-----------FPRELEILTKIDHSNIIQIHSILQRGPK 103
                |.||.:|.| |..|..:|..||           ...|..|.|.::|.|||:...|:....:
Yeast   448 AGGSVKLAQRISDNKIFAVKEFRTKFENESKRDYVKKITSEYCIGTTLNHPNIIETIEIVYENDR 512

  Fly   104 IFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAHRDLKCENILLSKRLNI 168
            |...|.|.|. ||.: |..|..:..::....|.|:...::|||::.:||||||.:|.:::::..:
Yeast   513 ILQVMEYCEY-DLFA-IVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVINEKGIV 575

  Fly   169 KLADFGFA---RYCRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLADAWSLGVILFIMMNAK 230
            ||.|||.|   .|....|  .:::....||..|.||||.....|||:..|.||..:|...|:..|
Yeast   576 KLIDFGAAVVFSYPFSKN--LVEASGIVGSDPYLAPEVCIFAKYDPRPVDIWSSAIIFACMILKK 638

  Fly   231 MP-----------------------------------FDDSNLTKL---------LEDQRNRKFA 251
            .|                                   :|:|:.|:.         :.|..|....
Yeast   639 FPWKIPKLRDNSFKLFCSGRDCDSLSSLVTRTPDPPSYDESHSTEKKKPESSSNNVSDPNNVNIG 703

  Fly   252 FRRKLQETISAQAKATVSVLLEPEAHARWNLREILNCAWLRTVE 295
            .:| |..::..:.:..|..:::.....|.|:.||:...|:|:::
Yeast   704 PQR-LLHSLPEETQHIVGRMIDLAPACRGNIEEIMEDPWIRSID 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 85/350 (24%)
S_TKc 28..287 CDD:214567 85/345 (25%)
NPR1NP_014216.1 PKc_like 451..742 CDD:419665 75/295 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.