DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and KKQ8

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_012753.2 Gene:KKQ8 / 853686 SGDID:S000001651 Length:724 Species:Saccharomyces cerevisiae


Alignment Length:313 Identity:77/313 - (24%)
Similarity:128/313 - (40%) Gaps:56/313 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NVGHK---IGEGSYATVITAG-------------YADDHGHGVHLACKIIDKAKAPTDFVNKFFP 77
            |.||.   :|.|:|..|....             |.|  ...::.|.|.: |.|..:| :.||..
Yeast   410 NYGHPVGLVGAGAYGEVKLCARLRNEKDSPPFETYHD--SKYIYYAVKEL-KPKPDSD-LEKFCT 470

  Fly    78 R---ELEILTKIDH---------SNIIQIHSILQRGPKIFIFMRYAENGDLLSHI----KRSGPI 126
            :   |..|...:.|         .||:.:..||:........|.:...|||...:    |..|.:
Yeast   471 KITSEFIIGHSLSHYHKNGKKPAPNILNVFDILEDSSSFIEVMEFCPAGDLYGMLVGKSKLKGRL 535

  Fly   127 DEKQSKIWFFQMSKALKYLHNLDIAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSET 191
            ...::..:..|:...:|::|:..|||.|||.||||......:|:.|||.:...:....|.:.::.
Yeast   536 HPLEADCFMKQLLHGVKFMHDHGIAHCDLKPENILFYPHGLLKICDFGTSSVFQTAWERRVHAQK 600

  Fly   192 -YCGSAAYAAP-EVVCGRPYDPKLADAWSLGVILFIMM-----------NAKMPFDDSNLTKLLE 243
             ..||..|.|| |.|.|..|||:|.|.||.||:...|:           ...|.:|:.    ..|
Yeast   601 GIIGSEPYVAPEEFVDGEYYDPRLIDCWSCGVVYITMILGHYLWKVASREKDMSYDEF----YKE 661

  Fly   244 DQRNRKFAFRRKLQET---ISAQAKATVSVLLEPEAHARWNLREILNCAWLRT 293
            .||..:|....:|:..   ::...|..:..:.:.|...|.::.::|:..|:::
Yeast   662 MQRKNQFRVFEELKHVNSELATNRKIALYRIFQWEPRKRISVGKLLDMQWMKS 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 76/309 (25%)
S_TKc 28..287 CDD:214567 75/305 (25%)
KKQ8NP_012753.2 PKc_like 418..712 CDD:419665 73/301 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.