DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and PTK2

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_012593.3 Gene:PTK2 / 853522 SGDID:S000003820 Length:818 Species:Saccharomyces cerevisiae


Alignment Length:285 Identity:76/285 - (26%)
Similarity:121/285 - (42%) Gaps:68/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KFFPR---ELEILTKIDHSNIIQIHSILQRGPKIFIFMRYAENG----------DLLSHIKRSG- 124
            ||:.|   |..|...:.|:..|.....|.:.|.    ..|...|          ||...::|:| 
Yeast   297 KFYKRCSKEFIIAKHLSHNVHITNTFYLLKVPT----TTYTTRGWGFIMELGVKDLFQLMERTGW 357

  Fly   125 ---PIDEKQSKIWFFQMSKALKYLHNLDIAHRDLKCENILLSKRLNIKLADFGFARYCR---DDN 183
               |.:||.  ..|.|:::.:|:.|:..|||||||.||:|:||....||.|||.:.:..   .|.
Yeast   358 KNVPFNEKY--CLFKQVAQGIKFCHDNGIAHRDLKPENVLISKEGICKLTDFGISDWYHVIPHDY 420

  Fly   184 GREMKS-ETYCGSAAYAAPEVV-----------CGRPYDPKLADAWSLGVILFIMMNAKMPFDDS 236
            ...:|: :...||..|..|||:           ..:||:|...|:::||::|..|:|..:||.||
Yeast   421 TSPVKTCQGMIGSPPYTPPEVMYFDAKKHYPEKFQKPYNPLAMDSYALGIMLITMINNIIPFIDS 485

  Fly   237 NLTKLLEDQRNRKFA-------------FRRK--------LQETISAQAKATVSV-----LLEPE 275
            ..|    |.|.|:|.             ||.|        .:.:::...|.|.:.     |.:|.
Yeast   486 CNT----DARFREFEVSYDNFINHQNPHFRDKGCHKPGPGSEYSLARNFKNTDATRIAWRLADPN 546

  Fly   276 AHARWNLREILNCAWLRTVEESQTP 300
            ...|:.:.::.|..:.:.:|....|
Yeast   547 PATRYTMDDLFNDPFFQQIETCVEP 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 74/274 (27%)
S_TKc 28..287 CDD:214567 73/270 (27%)
PTK2NP_012593.3 S_TKc 259..562 CDD:214567 74/274 (27%)
STKc_HAL4_like 261..562 CDD:270896 74/274 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.