DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and KIN1

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_010407.1 Gene:KIN1 / 851700 SGDID:S000002529 Length:1064 Species:Saccharomyces cerevisiae


Alignment Length:322 Identity:92/322 - (28%)
Similarity:153/322 - (47%) Gaps:55/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKYNSSAGIRQLGTRSSDVDALAQRGYNVGHKIGEGSYATVITA--GYADDHGHGVHLACKIIDK 64
            |:.:||.|:.:...|.|..|      :.....:|.||...|..|  .|.::     ..|.||:::
Yeast   100 SRVSSSQGMPKQFHRKSLGD------WEFVETVGAGSMGKVKLAKHRYTNE-----VCAVKIVNR 153

  Fly    65 A-KAPTDFVNK--FFP---RELEILTK-----------------------IDHSNIIQIHSILQR 100
            | ||   |::|  ..|   .|.::|.:                       :.|.:|.::..:...
Yeast   154 ATKA---FLHKEQMLPPPKNEQDVLERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTL 215

  Fly   101 GPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAHRDLKCENILLSKR 165
            ....::...|...|.||.:|.:.|.|.|.|::.:...::.||.|||..:|.|||||.|||::|..
Yeast   216 SNHFYMLFEYVSGGQLLDYIIQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDS 280

  Fly   166 LNIKLADFGFARYCRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLADAWSLGVILFIMMNAK 230
            ..||:.|||.:...  |:.:::  .|:|||..:||||::...||.....|.||.||:||:::..|
Yeast   281 SEIKIIDFGLSNIY--DSRKQL--HTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGK 341

  Fly   231 MPFDDSNLTKLLEDQRNRKFAFRRKLQ-ETISAQAKATVSVLLEPEAHARWNLREILNCAWL 291
            :||||.|.:.|.|..:..|..:.:.|. |.||..:|..|   ::|:..|  .|::::...|:
Yeast   342 VPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLV---VDPKRRA--TLKQVVEHHWM 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 84/295 (28%)
S_TKc 28..287 CDD:214567 84/290 (29%)
KIN1NP_010407.1 STKc_Kin1_2 118..398 CDD:270979 85/302 (28%)
MARK_C_like 890..1062 CDD:213377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.