DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and Tssk6

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_114393.1 Gene:Tssk6 / 83984 MGIID:2148775 Length:273 Species:Mus musculus


Alignment Length:273 Identity:114/273 - (41%)
Similarity:166/273 - (60%) Gaps:14/273 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LAQRGYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTKID 87
            |::.||.:|..||||||:.|..|......|   .:|.|::|:.:||.||||||.||||.||..:.
Mouse     7 LSELGYKLGRTIGEGSYSKVKVATSKKYKG---TVAIKVVDRRRAPPDFVNKFLPRELSILRGVR 68

  Fly    88 HSNIIQIHSILQ--RGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDI 150
            |.:|:.:...::  .| |::|.|..|.. |||..::|:|.|...|::..|.|::.|::|||:..:
Mouse    69 HPHIVHVFEFIEVCNG-KLYIVMEAAAT-DLLQAVQRNGRIPGSQARELFSQIAGAVRYLHDHHL 131

  Fly   151 AHRDLKCENILLS-KRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLA 214
            .||||||||:||| ....:|:.||||.|..   :|....|.|||||||||:|||:.|.|||||..
Mouse   132 VHRDLKCENVLLSPDERRVKITDFGFGRQA---HGYPDLSTTYCGSAAYASPEVLLGIPYDPKKY 193

  Fly   215 DAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVSVLLEPEAHAR 279
            |.|||||:|::|:...||||||::..|...|: |...:...|:  :|.:.|:.::.||:....||
Mouse   194 DVWSLGVVLYVMVTGCMPFDDSDIAGLPRRQK-RGVLYPDGLE--LSERCKSLIAELLQFSPSAR 255

  Fly   280 WNLREILNCAWLR 292
            .:..::....|||
Mouse   256 PSAGQVARNGWLR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 110/266 (41%)
S_TKc 28..287 CDD:214567 109/261 (42%)
Tssk6NP_114393.1 STKc_TSSK6-like 11..267 CDD:271066 110/266 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24343
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5387
SonicParanoid 1 1.000 - - X507
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
77.010

Return to query results.
Submit another query.