DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and AT3G61960

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_567122.1 Gene:AT3G61960 / 825369 AraportID:AT3G61960 Length:626 Species:Arabidopsis thaliana


Alignment Length:277 Identity:99/277 - (35%)
Similarity:142/277 - (51%) Gaps:15/277 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTKIDHSNII 92
            |.:|.:||.||:|.|..|.:   ...|:.:|.|.||| |..:..|.....:|:.||:.|||.|||
plant    10 YALGPRIGSGSFAVVWLAKH---RSSGLEVAVKEIDK-KLLSPKVRDNLLKEISILSTIDHPNII 70

  Fly    93 QIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAHRDLKC 157
            :.:..::.|.:||:.:.|...|||..:|.|.|.:.|..:|.:..|::..|:.|......|||||.
plant    71 RFYEAIETGDRIFLVLEYCSGGDLAGYINRHGKVPEAVAKHFMRQLALGLQVLQEKHFIHRDLKP 135

  Fly   158 ENILL-SKRLN--IKLADFGFARYCRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLADAWSL 219
            :|:|| ||.:.  :|:.||||||....    |..:||:|||..|.|||::..:.||.| ||.||.
plant   136 QNLLLSSKEVTPLLKIGDFGFARSLTP----ESMAETFCGSPLYMAPEIIRNQKYDAK-ADLWSA 195

  Fly   220 GVILFIMMNAKMPFDDSNLTKLLED-QRNRKFAFRRKLQETISAQAKATVSVLLEPEAHARWNLR 283
            |.|||.::..|.|||.:|..:|..: .|:.:..|....:..|..........||......|...|
plant   196 GAILFQLVTGKPPFDGNNHIQLFHNIVRDTELKFPEDTRNEIHPDCVDLCRSLLRRNPIERLTFR 260

  Fly   284 EILNCAWLRTVEESQTP 300
            |..|..:||  |..|.|
plant   261 EFFNHMFLR--EPRQIP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 94/266 (35%)
S_TKc 28..287 CDD:214567 93/262 (35%)
AT3G61960NP_567122.1 S_TKc 10..268 CDD:214567 94/266 (35%)
STKc_ATG1_ULK_like 16..267 CDD:270911 92/259 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.