DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and TSSK3

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_443073.1 Gene:TSSK3 / 81629 HGNCID:15473 Length:268 Species:Homo sapiens


Alignment Length:272 Identity:116/272 - (42%)
Similarity:171/272 - (62%) Gaps:10/272 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DALAQRGYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTK 85
            |.|...||.:|..||||:|:.|..| ::..|...|  |.|:|||...|.:|:.:|.||||:|:..
Human     3 DFLLSNGYQLGKTIGEGTYSKVKEA-FSKKHQRKV--AIKVIDKMGGPEEFIQRFLPRELQIVRT 64

  Fly    86 IDHSNIIQIHSILQRGP-KIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLD 149
            :||.||||::.:|:... ||.:.|..||.||:...:...||:.|.::|..|.||.:|::|.|...
Human    65 LDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVEAIRYCHGCG 129

  Fly   150 IAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLA 214
            :|||||||||.|| :..|:||.|||||:.....: ||: |:|:|||.|||||||:.|.|:|.|..
Human   130 VAHRDLKCENALL-QGFNLKLTDFGFAKVLPKSH-REL-SQTFCGSTAYAAPEVLQGIPHDSKKG 191

  Fly   215 DAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVSVLLEPEAHAR 279
            |.||:||:|::|:.|.:||||:::.|:|. |:.:..:|...|  :|||..:..:..||||:...|
Human   192 DVWSMGVVLYVMLCASLPFDDTDIPKMLW-QQQKGVSFPTHL--SISADCQDLLKRLLEPDMILR 253

  Fly   280 WNLREILNCAWL 291
            .::.|:....||
Human   254 PSIEEVSWHPWL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 112/264 (42%)
S_TKc 28..287 CDD:214567 111/259 (43%)
TSSK3NP_443073.1 STKc_TSSK3-like 9..265 CDD:271065 112/264 (42%)
S_TKc 10..265 CDD:214567 111/263 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1732
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X507
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.