DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and Tssk4

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001240817.1 Gene:Tssk4 / 71099 MGIID:1918349 Length:338 Species:Mus musculus


Alignment Length:298 Identity:112/298 - (37%)
Similarity:167/298 - (56%) Gaps:29/298 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LAQRGYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTKID 87
            :.:.||.||..||.|||.||..|.|....   |.:|.|||.|.||..|::|||.|||::::..:.
Mouse    20 MEEYGYEVGKIIGHGSYGTVYEAYYTKQK---VMVAVKIISKKKASEDYLNKFLPREIQVMKVLR 81

  Fly    88 HSNIIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAH 152
            |..:|..:..::...:::|.:..|:.||:|..|:|.|...|..:..||.||:..:.|||:..|.|
Mouse    82 HKYLINFYQAIETTSRVYIILELAQGGDVLEWIQRYGACAETLAGKWFSQMALGIAYLHSKGIVH 146

  Fly   153 ----------RDLKCENILLSKRLNIKLADFGFARYC------------RDDNGREMKSETYCGS 195
                      ||||.||:||.||.|:|::|||||:..            |..|.....|:|||||
Mouse   147 RLTPSLSAAGRDLKLENLLLDKRENVKISDFGFAKMVPSSQPVHSSPSYRQMNSLSHLSQTYCGS 211

  Fly   196 AAYAAPEVVCGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETI 260
            .|||.||::.|.||:|.|:|.||:||||:.::.|::||||:||.|||.:.: ::..|...|  ||
Mouse   212 FAYACPEILLGLPYNPFLSDTWSMGVILYTLVVARLPFDDTNLKKLLRETQ-KEVTFPANL--TI 273

  Fly   261 SAQAKATVSVLLEPEAHARWNLREILNCAWLRTVEESQ 298
            |.:.|..:..||. ::..|..:.::|...|:...:..|
Mouse   274 SQECKNLILQLLR-QSTKRATILDVLRDPWMLKFQPEQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 110/285 (39%)
S_TKc 28..287 CDD:214567 108/280 (39%)
Tssk4NP_001240817.1 STKc_TSSK4-like 24..302 CDD:271064 110/284 (39%)
S_TKc 25..303 CDD:214567 109/284 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103794
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X507
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.