DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and tssk6

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001038310.1 Gene:tssk6 / 557915 ZFINID:ZDB-GENE-060216-3 Length:268 Species:Danio rerio


Alignment Length:275 Identity:110/275 - (40%)
Similarity:159/275 - (57%) Gaps:13/275 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DALAQRGYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTK 85
            :.|...||.....|||||::.|   ..|....|...:|.||:|:.:...||:.||.||||.:|.:
Zfish     5 NVLKGMGYTFLTSIGEGSFSRV---KLATSQKHCCKVAIKIVDRMRGSADFIQKFLPRELAVLRR 66

  Fly    86 IDHSNIIQIHSILQ-RGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLD 149
            ::|.||||:...:: .|.::.|.|..||. |||..|.....|.:..||..|.||..|:.|||.::
Zfish    67 VNHENIIQMFECIEVAGKRLCIVMEAAEK-DLLQKIHEVHHIPKDLSKTMFAQMVSAINYLHQMN 130

  Fly   150 IAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLA 214
            |.|||||||||||:....||:|||||||:..|.:  |: |.|:|||.||..|||:.|.|||||..
Zfish   131 IVHRDLKCENILLTADEKIKIADFGFARFVEDPS--EL-SHTFCGSRAYTPPEVITGTPYDPKKY 192

  Fly   215 DAWSLGVILFIMMNAKMPFDDSNLTKL-LEDQRNRKFAFRRKLQETISAQAKATVSVLLEPEAHA 278
            |.|||||||::|:...||:|::|:.:| |..||...:.....::|    ..:..:..||:.....
Zfish   193 DVWSLGVILYVMVTGTMPYDETNVRRLRLLQQRPLNYPSNVAVEE----PCRVFIRTLLQTNPST 253

  Fly   279 RWNLREILNCAWLRT 293
            |..::::...:||::
Zfish   254 RPTIQQVAGHSWLQS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 107/265 (40%)
S_TKc 28..287 CDD:214567 106/260 (41%)
tssk6NP_001038310.1 STKc_TSSK6-like 11..266 CDD:271066 107/265 (40%)
S_TKc 12..266 CDD:214567 106/264 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3262
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3853
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto39709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24343
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5387
SonicParanoid 1 1.000 - - X507
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
99.060

Return to query results.
Submit another query.