DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and CG17698

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001036633.2 Gene:CG17698 / 4379919 FlyBaseID:FBgn0040056 Length:694 Species:Drosophila melanogaster


Alignment Length:321 Identity:80/321 - (24%)
Similarity:137/321 - (42%) Gaps:67/321 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YNVGHKIGEGSYATVITAGYADDHGHGVHLACKIID----------------KAKAPTDFVNKFF 76
            |.:..:||:|||..|..|...:|   ..|.|.||:.                ||.:|.|.|.   
  Fly   283 YRLMEQIGQGSYGLVKLAYSEED---STHYAMKILSKKRLLRQAGLMRRGPRKATSPLDRVY--- 341

  Fly    77 PRELEILTKIDHSNIIQIHSILQRGP---KIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQM 138
             ||:.:|.|:||.|::::..:|. .|   .:::.....:.|::| .|....|:.||::...|.:.
  Fly   342 -REIAVLKKLDHPNVVKLVEVLD-DPLEDSLYMVFELVKQGEVL-RIPTDNPLSEKRAWSIFRES 403

  Fly   139 SKALKY------------------LHNLDIAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGR 185
            ...|:|                  :|:..|.|.|:|..|:||::..::|:||.|.......|:..
  Fly   404 LLGLEYYTMLSSSAISLKRIFVYTVHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDAT 468

  Fly   186 EMKSETYCGSAAYAAPEVV-------CGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLLE 243
            .....| .|:.|:.|||.:       |||     .||.|:||..|:.::...:||...::..|.|
  Fly   469 ISNGST-AGTPAFRAPETLIPGQNEYCGR-----AADVWALGATLYSLIFGNVPFLADSVPLLYE 527

  Fly   244 --DQRNRKFAFRRKLQETISAQAKATVSVLLEPEAHARWNLREILNCAWLRTVEESQTPIP 302
              .|.:.||....|:.|.:    |:.:..:||.....|..:.::....|:  ..:...|:|
  Fly   528 KIKQDSVKFPENHKVTENL----KSCIVQMLEKNPTQRITIPQLKTSKWV--TSDGDYPLP 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 77/308 (25%)
S_TKc 28..287 CDD:214567 77/304 (25%)
CG17698NP_001036633.2 S_TKc 283..573 CDD:214567 77/308 (25%)
STKc_CAMKK 288..574 CDD:271020 77/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.