DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and CG10177

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster


Alignment Length:237 Identity:62/237 - (26%)
Similarity:118/237 - (49%) Gaps:22/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KIIDKAKAPTDFVNKFFPRELEILTKI-DHSNIIQIHSILQRGPKIFIFMRYAENGDLLSHIKRS 123
            |:::|.....|..:.:.  |.|:|.:: .|.|||::...::....::..:.:.: .::...|::.
  Fly   178 KMVNKQTQSNDRGDTYM--EAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLD-CNMQKVIQKR 239

  Fly   124 GPIDEKQSKIWFFQMSKALKYLHNLDIAHRDLKCENILL---SKRLN---IKLADFGFARYCRDD 182
            |.:.|..::........||.::|.|.:.|||:|.||:|:   |.:.|   :|:|:|..|.|.|. 
  Fly   240 GILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRG- 303

  Fly   183 NGREMKSETY--CGSAAYAAPEVVCGRPYDPKLADAWSLGVILFIMMNAKMPFDDS--NLTKLLE 243
                  |:.|  ||:..|.|||::....||.:: |:|||||.||.|:..||||..:  |..::..
  Fly   304 ------SKLYVRCGTPCYMAPEMIAMSGYDYQV-DSWSLGVTLFYMLCGKMPFASACKNSKEIYA 361

  Fly   244 DQRNRKFAFRRKLQETISAQAKATVSVLLEPEAHARWNLREI 285
            ...:....:.:.::..:|.:|...:..||..:...|..:.|:
  Fly   362 AIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAEL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 62/237 (26%)
S_TKc 28..287 CDD:214567 62/237 (26%)
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 62/237 (26%)
PKc_like 164..403 CDD:304357 61/235 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.