DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and sff

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster


Alignment Length:270 Identity:84/270 - (31%)
Similarity:137/270 - (50%) Gaps:24/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YNVGHKIGEGSYATVITAGYADDHGHGVH------LACKIIDKAKAPTDFVNKFFPRELEILTKI 86
            |.:...:|:|....|..         |||      :|.|||::.|.....:.| ..||:.|:..|
  Fly    18 YRLEKTLGKGQTGLVKL---------GVHCVIGKKVAIKIINREKLSESVLMK-VEREIAIMKLI 72

  Fly    87 DHSNIIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIA 151
            ||.:::.:..:.:....:::.:.:...|:|..::.:.|.:..|:::.:|.|:..||.:.|:..|.
  Fly    73 DHPHVLGLSDVYENKKYLYLILEHVSGGELFDYLVKKGRLTPKEARKFFRQIISALDFCHSHSIC 137

  Fly   152 HRDLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLADA 216
            |||||.||:||.::.|||:||||.|..  ...|..:  ||.|||..||.|||:.|..||.:.||.
  Fly   138 HRDLKPENLLLDEKNNIKIADFGMASL--QPAGSML--ETSCGSPHYACPEVIRGEKYDGRKADV 198

  Fly   217 WSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVSVLLEPEAHARWN 281
            ||.||||:.::...:||||.||.:|||..:...|    .:...:....::.:..::|.....|..
  Fly   199 WSCGVILYALLVGALPFDDDNLRQLLEKVKRGVF----HIPHFVPPDCQSLLRGMIEVNPDRRLT 259

  Fly   282 LREILNCAWL 291
            |.||....|:
  Fly   260 LAEINRHPWV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 83/268 (31%)
S_TKc 28..287 CDD:214567 83/264 (31%)
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 83/268 (31%)
S_TKc 18..269 CDD:214567 83/268 (31%)
UBA_BRSK 298..350 CDD:270525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.