DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and CG8485

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster


Alignment Length:273 Identity:82/273 - (30%)
Similarity:150/273 - (54%) Gaps:18/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNK--FFPRELEILTKIDHSN 90
            |::...:|.|.:|.|..|.:...   |..:|.|::||.|  .|.|:|  .| :|:..:..:.|.|
  Fly    20 YDLEETLGSGHFAVVKLARHVFT---GAKVAVKVVDKTK--LDDVSKAHLF-QEVRCMKLVQHPN 78

  Fly    91 IIQIHSILQRGPKIFIFMRYAENGDLLSHI-KRSGPIDEKQSKIWFFQMSKALKYLHNLDIAHRD 154
            :::::.::....|:::.:...:.|||..:| |....:.|:.::.:|.|:.:|:.|.|.|.:.|||
  Fly    79 VVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFRQILRAITYCHQLHVVHRD 143

  Fly   155 LKCENILLSKRLN-IKLADFGFARYCRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLADAWS 218
            ||.||::..::|. :||.||||:......    .|.||:|||.||:|||::.|..||....|.||
  Fly   144 LKPENVVFFEKLGLVKLTDFGFSNKFLPG----QKLETFCGSLAYSAPEILLGDSYDAPAVDIWS 204

  Fly   219 LGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVSVLLEPEAHARWNLR 283
            |||||::::..:.||:.:|.::.|....:.|:.    :...:|...:..::.:|..:...|..:.
  Fly   205 LGVILYMLVCGQAPFEKANDSETLTMIMDCKYT----VPSHVSTDCRDLIASMLVRDPKKRATVE 265

  Fly   284 EILNCAWLRTVEE 296
            ||.:.|||:.::|
  Fly   266 EIASSAWLKPIDE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 79/266 (30%)
S_TKc 28..287 CDD:214567 78/262 (30%)
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 79/266 (30%)
S_TKc 20..273 CDD:214567 79/266 (30%)
UBA_SNRK 296..338 CDD:270524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461617
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.