DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and CG4629

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster


Alignment Length:207 Identity:66/207 - (31%)
Similarity:109/207 - (52%) Gaps:18/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IGEGSYATVITAGYADDHGHGVH------LACKIIDKAKAPTDF-VNKFFPRELEILTKIDHSNI 91
            ||.|:::.|..|         ||      :|.|::|..:|..|. ..:....|:..|..:.|.||
  Fly    72 IGRGNFSKVKLA---------VHQLTRDKVAIKVVDLDRAGLDAKALRMLSSEIATLECVHHPNI 127

  Fly    92 IQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAHRDLK 156
            :::..:::...::::...:...|:|.:||.:.||:.|..:.....|:..|:|::|:|...|||:|
  Fly   128 LRLFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHSLGYVHRDIK 192

  Fly   157 CENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLADAWSLGV 221
            .||:||.....:|||||||:...  .||...|.:|:|||..|||||:.....|.....|.|:||:
  Fly   193 AENVLLLSEDRLKLADFGFSTQL--INGANQKLDTFCGSPPYAAPELFSDDHYIGAPVDVWALGI 255

  Fly   222 ILFIMMNAKMPF 233
            :|:.|:...|||
  Fly   256 LLYFMVVGNMPF 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 66/207 (32%)
S_TKc 28..287 CDD:214567 66/207 (32%)
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 66/207 (32%)
S_TKc 66..321 CDD:214567 66/207 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.