DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and Sik2

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_569972.1 Gene:Sik2 / 31170 FlyBaseID:FBgn0025625 Length:1398 Species:Drosophila melanogaster


Alignment Length:267 Identity:88/267 - (32%)
Similarity:152/267 - (56%) Gaps:18/267 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YNVGHKIGEGSYATVITAGYADDHGHGV---HLACKIIDKAKAPTDFVNKFFPRELEILTKIDHS 89
            |::...||:|::|.|..|      .|.:   .:|.|||||::.....:.|.: ||:||:.::.|.
  Fly   141 YDIERTIGKGNFAVVKLA------RHRITKNEVAIKIIDKSQLDQTNLQKVY-REVEIMKRLKHP 198

  Fly    90 NIIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAHRD 154
            :||:::.:::....|:|...||..|::..:|.:.|.:.|..::..|:|:..|::|.|...|.|||
  Fly   199 HIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIISAVEYCHKKGIVHRD 263

  Fly   155 LKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLADAWSL 219
            ||.||:||...:|||:|||||:.:.:..   |:.: |:|||..||||||..|:.|.....|.|||
  Fly   264 LKAENLLLDLNMNIKIADFGFSNHFKPG---ELLA-TWCGSPPYAAPEVFEGKQYTGPEIDIWSL 324

  Fly   220 GVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVSVLLEPEAHARWNLRE 284
            ||:|::::...:|||.|.|..|    |:|..:.|.::...:|::.:..:..:|..|...|:.:.:
  Fly   325 GVVLYVLVCGALPFDGSTLQSL----RDRVLSGRFRIPFFMSSECEHLIRRMLVLEPTRRYTIDQ 385

  Fly   285 ILNCAWL 291
            |....|:
  Fly   386 IKRHRWM 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 87/265 (33%)
S_TKc 28..287 CDD:214567 87/261 (33%)
Sik2NP_569972.1 STKc_SIK 140..392 CDD:270973 87/265 (33%)
S_TKc 141..392 CDD:214567 87/265 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.