DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and Tssk2

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001012019.1 Gene:Tssk2 / 304181 RGDID:1304951 Length:358 Species:Rattus norvegicus


Alignment Length:286 Identity:130/286 - (45%)
Similarity:187/286 - (65%) Gaps:13/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DVDALAQRGYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEIL 83
            |...|.::||.||..:|:||||.|.:| |::.....|  |.||||:.|.|||||.:|.|||::||
  Rat     3 DAAVLRKKGYIVGINLGKGSYAKVKSA-YSERLKFNV--AVKIIDRKKTPTDFVERFLPREMDIL 64

  Fly    84 TKIDHSNIIQIHSILQRGP-KIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHN 147
            ..::|.:||:.:.|.:... :|:|.|.....||||..||..|.:.|..::..|.|:|.|:||.|:
  Rat    65 ATVNHRSIIKTYEIFETSDGRIYIVMELGVQGDLLEFIKCRGALHEDVARKMFRQLSSAVKYCHD 129

  Fly   148 LDIAHRDLKCENILLSKRLNIKLADFGFARYC-RDDNGREMKSETYCGSAAYAAPEVVCGRPYDP 211
            ||:.||||||||:||.|..||||:||||::.| ||.:||.:.|:|:|||||||||||:.|.||.|
  Rat   130 LDVVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDGSGRIVLSKTFCGSAAYAAPEVLQGIPYQP 194

  Fly   212 KLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVSVLLEPEA 276
            |:.|.|||||||:||:...||:|||::.|:|..|:..:..|.|  .:.::.:.|..:..:|:|:.
  Rat   195 KVYDIWSLGVILYIMVCGSMPYDDSDIKKMLRIQKEHRVDFPR--SKNLTGECKDLIYRILQPDV 257

  Fly   277 HARWNLREILNCAWLRTVEESQTPIP 302
            :.|.::.|||:.:||      |.|.|
  Rat   258 NRRLHIDEILSHSWL------QPPKP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 123/265 (46%)
S_TKc 28..287 CDD:214567 121/260 (47%)
Tssk2NP_001012019.1 STKc_TSSK1_2-like 10..272 CDD:271067 123/266 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 238 1.000 Domainoid score I2219
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 249 1.000 Inparanoid score I3155
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 1 1.000 - - FOG0007569
OrthoInspector 1 1.000 - - otm46418
orthoMCL 1 0.900 - - OOG6_103794
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X507
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.