DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and TSSK4

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001171668.1 Gene:TSSK4 / 283629 HGNCID:19825 Length:338 Species:Homo sapiens


Alignment Length:295 Identity:111/295 - (37%)
Similarity:163/295 - (55%) Gaps:31/295 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTKIDHSNI 91
            ||.||..||.|||.:|..|.|....   |.:|.|||.|.||..|::|||.|||::::..:.|..:
Human    24 GYEVGKAIGHGSYGSVYEAFYTKQK---VMVAVKIISKKKASDDYLNKFLPREIQVMKVLRHKYL 85

  Fly    92 IQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAH---- 152
            |..:..::...:::|.:..|:.||:|..|:|.|...|..:..||.|::..:.|||:..|.|    
Human    86 INFYRAIESTSRVYIILELAQGGDVLEWIQRYGACSEPLAGKWFSQLTLGIAYLHSKSIVHRLMP 150

  Fly   153 ------RDLKCENILLSKRLNIKLADFGFARY--------C----RDDNGREMKSETYCGSAAYA 199
                  ||||.||:||.|..|:|::|||||:.        |    |..|.....|:|||||.|||
Human   151 SLSAAGRDLKLENLLLDKWENVKISDFGFAKMVPSNQPVGCSPSYRQVNCFSHLSQTYCGSFAYA 215

  Fly   200 APEVVCGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLL-EDQRNRKFAFRRKLQETISAQ 263
            .||::.|.||:|.|:|.||:||||:.::.|.:||||:||.||| |.|:...|    ....|||.:
Human   216 CPEILRGLPYNPFLSDTWSMGVILYTLVVAHLPFDDTNLKKLLRETQKEVTF----PANHTISQE 276

  Fly   264 AKATVSVLLEPEAHARWNLREILNCAWLRTVEESQ 298
            .|..:..:|. :|..|..:.:|:..:|:...:..|
Human   277 CKNLILQMLR-QATKRATILDIIKDSWVLKFQPEQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 109/286 (38%)
S_TKc 28..287 CDD:214567 108/281 (38%)
TSSK4NP_001171668.1 STKc_TSSK4-like 24..303 CDD:271064 109/286 (38%)
S_TKc 25..303 CDD:214567 108/285 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103794
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X507
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.