DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and kin1

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_596106.1 Gene:kin1 / 2540792 PomBaseID:SPBC4F6.06 Length:891 Species:Schizosaccharomyces pombe


Alignment Length:289 Identity:88/289 - (30%)
Similarity:136/289 - (47%) Gaps:43/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YNVGHKIGEGSYATVITAGYADDHGHGVHLACKI-------IDKAKAPTDF---------VNKFF 76
            |.:|..||.||...|..|.:...   |...|.||       |.||||....         .||..
pombe   125 YVLGKTIGAGSMGKVKVAHHLKT---GEQFAIKIVTRLHPDITKAKAAASAEATKAAQSEKNKEI 186

  Fly    77 --PRELEILTKIDHSNIIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMS 139
              .||..:.|.:.|..|.:...:.......::...:.:.|.:|.:|...|.:.|||::.:..|:.
pombe   187 RTVREAALSTLLRHPYICEARDVYITNSHYYMVFEFVDGGQMLDYIISHGKLKEKQARKFVRQIG 251

  Fly   140 KALKYLHNLDIAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAAPEVV 204
            .||.|||...:.|||||.||||:||..:||:.|||.:...|    |:.:..|:|||..:||||::
pombe   252 SALSYLHQNSVVHRDLKIENILISKTGDIKIIDFGLSNLYR----RQSRLRTFCGSLYFAAPELL 312

  Fly   205 CGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQE-------TISA 262
            ..:||.....|.||.|::|::::..|:||||.|::           |...|:::       .:|:
pombe   313 NAQPYIGPEVDVWSFGIVLYVLVCGKVPFDDQNMS-----------ALHAKIKKGTVEYPSYLSS 366

  Fly   263 QAKATVSVLLEPEAHARWNLREILNCAWL 291
            ..|..:|.:|..:...|..|.|:||..|:
pombe   367 DCKGLLSRMLVTDPLKRATLEEVLNHPWM 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 87/287 (30%)
S_TKc 28..287 CDD:214567 85/283 (30%)
kin1NP_596106.1 STKc_Kin1_2 123..395 CDD:270979 87/287 (30%)
S_TKc 125..395 CDD:214567 87/287 (30%)
MARK_C_like 753..889 CDD:213377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.