DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and TSSK2

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_443732.3 Gene:TSSK2 / 23617 HGNCID:11401 Length:358 Species:Homo sapiens


Alignment Length:286 Identity:131/286 - (45%)
Similarity:185/286 - (64%) Gaps:13/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DVDALAQRGYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEIL 83
            |...|.::||.||..:|:||||.|.:| |::.....|  |.||||:.|.|||||.:|.|||::||
Human     3 DATVLRKKGYIVGINLGKGSYAKVKSA-YSERLKFNV--AVKIIDRKKTPTDFVERFLPREMDIL 64

  Fly    84 TKIDHSNIIQIHSILQRGP-KIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHN 147
            ..::|.:||:.:.|.:... :|:|.|.....||||..||..|.:.|..::..|.|:|.|:||.|:
Human    65 ATVNHGSIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHD 129

  Fly   148 LDIAHRDLKCENILLSKRLNIKLADFGFARYC-RDDNGREMKSETYCGSAAYAAPEVVCGRPYDP 211
            |||.||||||||:||.|..||||:||||::.| ||.|||.:.|:|:|||||||||||:...||.|
Human   130 LDIVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQP 194

  Fly   212 KLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVSVLLEPEA 276
            |:.|.|||||||:||:...||:|||::.|:|..|:..:..|.|  .:.::.:.|..:..:|:|:.
Human   195 KVYDIWSLGVILYIMVCGSMPYDDSDIRKMLRIQKEHRVDFPR--SKNLTCECKDLIYRMLQPDV 257

  Fly   277 HARWNLREILNCAWLRTVEESQTPIP 302
            ..|.::.|||:.:||      |.|.|
Human   258 SQRLHIDEILSHSWL------QPPKP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 124/265 (47%)
S_TKc 28..287 CDD:214567 122/260 (47%)
TSSK2NP_443732.3 STKc_TSSK1_2-like 10..272 CDD:271067 124/266 (47%)
S_TKc 12..272 CDD:214567 123/264 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BHY0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I3315
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007569
OrthoInspector 1 1.000 - - otm42266
orthoMCL 1 0.900 - - OOG6_103794
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5387
SonicParanoid 1 1.000 - - X507
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.