DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and Tssk1

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_033461.2 Gene:Tssk1 / 22114 MGIID:1347557 Length:365 Species:Mus musculus


Alignment Length:305 Identity:135/305 - (44%)
Similarity:190/305 - (62%) Gaps:26/305 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DVDALAQRGYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEIL 83
            |...|.:|||.:|..:||||||.|.:| |::.....|  |.||||:.|||:||:.||.|||:|||
Mouse     3 DAAVLKRRGYIMGINLGEGSYAKVKSA-YSERLKFNV--AVKIIDRKKAPSDFLEKFLPREIEIL 64

  Fly    84 TKIDHSNIIQIHSILQRGP-KIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHN 147
            ..::|.:|::.:.|.:... |::|.|.....||||..||..|.:.|..::..|.|:|.|:||.|:
Mouse    65 AMLNHRSIVKTYEIFETSDGKVYIVMELGVQGDLLEFIKTRGALQEDDARKKFHQLSSAIKYCHD 129

  Fly   148 LDIAHRDLKCENILLSKRLNIKLADFGFARYC-RDDNGREMKSETYCGSAAYAAPEVVCGRPYDP 211
            ||:.||||||||:||.|..||||:||||::.| |||:||.:.|:|:|||||||||||:.|.||.|
Mouse   130 LDVVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDDSGRLILSKTFCGSAAYAAPEVLQGIPYQP 194

  Fly   212 KLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQETISAQAKATVSVLLEPEA 276
            |:.|.|||||||:||:...||:||||:.|:|..|:..:..|.|  .:.::.:.|..:..:|:|:.
Mouse   195 KVYDIWSLGVILYIMVCGSMPYDDSNIKKMLRIQKEHRVNFPR--SKHLTGECKDLIYRMLQPDV 257

  Fly   277 HARWNLREILNCAWL-------------------RTVEESQTPIP 302
            :.|.::.||||..|:                   |..|.|..|.|
Mouse   258 NRRLHIDEILNHCWVQPKARGLSSGAINKEGESSRATEPSWIPEP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 126/265 (48%)
S_TKc 28..287 CDD:214567 123/260 (47%)
Tssk1NP_033461.2 STKc_TSSK1_2-like 10..271 CDD:271067 127/265 (48%)
S_TKc 12..272 CDD:214567 125/264 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..365 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 240 1.000 Domainoid score I2249
eggNOG 1 0.900 - - E33208_3BHY0
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56448
Inparanoid 1 1.050 250 1.000 Inparanoid score I3212
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 1 1.000 - - FOG0007569
OrthoInspector 1 1.000 - - otm44320
orthoMCL 1 0.900 - - OOG6_103794
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5387
SonicParanoid 1 1.000 - - X507
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.