DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14305 and W02B12.12

DIOPT Version :9

Sequence 1:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001022385.1 Gene:W02B12.12 / 174755 WormBaseID:WBGene00012207 Length:367 Species:Caenorhabditis elegans


Alignment Length:232 Identity:86/232 - (37%)
Similarity:142/232 - (61%) Gaps:11/232 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ALAQRGYNV--GHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAKAPTDFVNKFFPRELEILT 84
            |.|::|.::  .:|:|.|.|:.|..   |.|..:...:|.|.||..:..||...||.||||....
 Worm    86 AFARKGMDLDTSNKLGRGKYSKVYK---AFDRNNNRVVAVKAIDTQELTTDVKMKFLPRELSCWR 147

  Fly    85 KIDHSNIIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLD 149
            |:.:..::.:|:..:....||:.|.|...||||.:::..|.|.|:::.::..|:.:.|:::|:::
 Worm   148 KLKNPFVVGLHAQYEAQSMIFLTMEYGSQGDLLRYVQEHGGIHEQKAGLFMSQLIRGLQFMHSIN 212

  Fly   150 IAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLA 214
            |||||:|.|||:|.... :||:||||.|. .|::.   .|.|:|||.:|:|||::.|..|:|.|:
 Worm   213 IAHRDIKLENIILFDNC-VKLSDFGFVRK-MDESA---LSSTFCGSKSYSAPELLRGIVYNPFLS 272

  Fly   215 DAWSLGVILFIMMNAKMPFDDSNLTK-LLEDQRNRKF 250
            |.|||||:.|:|:..:||||:..... ::|.||||::
 Worm   273 DVWSLGVVGFVMVTNRMPFDEKKPNNVIVELQRNRQY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 84/227 (37%)
S_TKc 28..287 CDD:214567 83/226 (37%)
W02B12.12NP_001022385.1 PKc_like 99..348 CDD:389743 83/219 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X507
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.