DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and YBR062C

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_009618.2 Gene:YBR062C / 852354 SGDID:S000000266 Length:180 Species:Saccharomyces cerevisiae


Alignment Length:67 Identity:23/67 - (34%)
Similarity:35/67 - (52%) Gaps:14/67 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CSVCKEPAEEGQKYRI---LP-CKHEFHEECILLWLKKTNSCPLCR---------YELETDDPVY 121
            ||:|.....| .:|.:   || |.|:|..||:.:||.::.:|||||         .|::|.:...
Yeast   109 CSICYTNYLE-DEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAEL 172

  Fly   122 EE 123
            ||
Yeast   173 EE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 17/44 (39%)
YBR062CNP_009618.2 RING_Ubox 109..153 CDD:418438 17/44 (39%)
RING-H2 finger (C3H2C3-type) 109..152 CDD:319361 16/43 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2782
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.