powered by:
Protein Alignment CG7694 and YBR062C
DIOPT Version :9
Sequence 1: | NP_001138076.1 |
Gene: | CG7694 / 42230 |
FlyBaseID: | FBgn0038627 |
Length: | 147 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009618.2 |
Gene: | YBR062C / 852354 |
SGDID: | S000000266 |
Length: | 180 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 67 |
Identity: | 23/67 - (34%) |
Similarity: | 35/67 - (52%) |
Gaps: | 14/67 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 CSVCKEPAEEGQKYRI---LP-CKHEFHEECILLWLKKTNSCPLCR---------YELETDDPVY 121
||:|.....| .:|.: || |.|:|..||:.:||.::.:||||| .|::|.:...
Yeast 109 CSICYTNYLE-DEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAEL 172
Fly 122 EE 123
||
Yeast 173 EE 174
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S2782 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.