DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and AT1G60360

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_176239.1 Gene:AT1G60360 / 842331 AraportID:AT1G60360 Length:327 Species:Arabidopsis thaliana


Alignment Length:146 Identity:48/146 - (32%)
Similarity:68/146 - (46%) Gaps:21/146 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HEPTGPLGANDLA-------RNLKRLQVLAIMNGIDMEIE---------VPEASKRAILELPVHE 58
            :.||.||| |.:|       |::.........:.::..||         .|.||:..|..||..:
plant   148 NNPTSPLG-NIIAPPNQAPPRHVNSHDYFTGASSLEQLIEQLTQDDRPGPPPASEPTINSLPSVK 211

  Fly    59 IVKSDEGGDL-ECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELETDDPVYE 122
            |.......|: :|:||.|....|.....|||||.:|::||:.||:..||||:||.:|...:.|.|
plant   212 ITPQHLTNDMSQCTVCMEEFIVGGDATELPCKHIYHKDCIVPWLRLNNSCPICRRDLPLVNTVAE 276

  Fly   123 ELRR---FRQDEANRR 135
            ...|   .|||...||
plant   277 SRERSNPIRQDMPERR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 19/41 (46%)
AT1G60360NP_176239.1 zinc_ribbon_9 24..56 CDD:373030
RAD18 199..>325 CDD:227719 37/94 (39%)
RING_Ubox 223..265 CDD:388418 19/41 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 1 1.000 - - otm2840
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15710
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.