DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and AT1G57730

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_176085.1 Gene:AT1G57730 / 842148 AraportID:AT1G57730 Length:174 Species:Arabidopsis thaliana


Alignment Length:103 Identity:34/103 - (33%)
Similarity:53/103 - (51%) Gaps:15/103 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 MNGIDMEIEVPEASKRA------ILELPVHEIVKSDEGGDLE---CSVCKEP-AEEGQKYRILP- 87
            ::|..:.:|:..||:|.      .|.:.|..:.:|.....||   |::|.|. :::...|:.:| 
plant    71 ISGTRLCVEMALASERVPAPFDMYLHVTVRFVEESTSSSPLENKTCAICLEDMSQDVHDYQEMPN 135

  Fly    88 CKHEFHEECILLWLKKTNSCPLCRYELETDD----PVY 121
            |.|.||.:||..||..:|.|||||..||.:|    |.|
plant   136 CPHVFHNDCIYKWLGHSNLCPLCRTVLEDEDDDDYPYY 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 18/46 (39%)
AT1G57730NP_176085.1 zf-RING_2 115..159 CDD:290367 17/43 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I2613
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.