DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and AT1G55530

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001321432.1 Gene:AT1G55530 / 842000 AraportID:AT1G55530 Length:351 Species:Arabidopsis thaliana


Alignment Length:179 Identity:47/179 - (26%)
Similarity:71/179 - (39%) Gaps:58/179 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EPTGPLGANDLAR----NLKRLQVLAIMNGIDME------------------------------I 41
            |.||. |.|:..|    |... |.:.:.|..||:                              .
plant   137 ESTGN-GGNNPGRVILINTSN-QTITVQNSADMDSVPAGSLGDYFIGPGFEMLLQRLAENDPNRY 199

  Fly    42 EVPEASKRAILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNS 106
            ..|.|.|.|:..|..   ||.:|  .|:||||.:..|.|.:.:::||.|:||.:|:|.||:..:|
plant   200 GTPPAKKEAVEALAT---VKIEE--TLQCSVCLDDFEIGTEAKLMPCTHKFHSDCLLPWLELHSS 259

  Fly   107 CPLCRYELETDDPVYEEL-----------------RRFRQDEANRRERE 138
            ||:|||:|..|:...:.:                 ......:.|||:.|
plant   260 CPVCRYQLPADEAKTDSVTTTSDNNGSSSASATTSHGAENSDGNRRQEE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 18/41 (44%)
AT1G55530NP_001321432.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 1 1.000 - - otm2840
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15710
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.