DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and AT1G18770

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_173312.1 Gene:AT1G18770 / 838459 AraportID:AT1G18770 Length:106 Species:Arabidopsis thaliana


Alignment Length:98 Identity:30/98 - (30%)
Similarity:53/98 - (54%) Gaps:8/98 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NDLARNLKRLQVLAIMNGIDMEIEVPEASKRAILELPVHEIVK--SDEGGDLECSVCKEPAEEGQ 81
            |....|...:.|.|.::|.:     |..:.:.:::....:|.|  :...|:: |.:|.|...||:
plant    12 NPQPENEGTITVNAKIDGYN-----PTPASKLVVKSLARKIYKMTTSSTGEM-CIICLEEFSEGR 70

  Fly    82 KYRILPCKHEFHEECILLWLKKTNSCPLCRYEL 114
            :...|||.|:|.:||:|.|.:..:||||||::|
plant    71 RVVTLPCGHDFDDECVLKWFETNHSCPLCRFKL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 18/41 (44%)
AT1G18770NP_173312.1 zf-RING_2 58..100 CDD:404518 18/42 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15710
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.