DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and AT5G37230

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_198539.1 Gene:AT5G37230 / 833697 AraportID:AT5G37230 Length:208 Species:Arabidopsis thaliana


Alignment Length:95 Identity:33/95 - (34%)
Similarity:46/95 - (48%) Gaps:14/95 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IDMEIEVPEASKRA------ILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRI--LP-CKHEF 92
            :..::.:|....|:      :||....|:....:..:..||:|.|...|.....|  || |.|.|
plant   114 VTRDVMLPSIVVRSRDMFQRLLEEQTMELTNLGDEEETTCSICMEDFSESHDDNIILLPDCFHLF 178

  Fly    93 HEECILLWLKKTNSCPLCR---YE--LETD 117
            |:.||..|||:..||||||   ||  |||:
plant   179 HQSCIFKWLKRQRSCPLCRRVPYEEDLETE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 21/44 (48%)
AT5G37230NP_198539.1 RING-H2_PA-TM-RING 152..197 CDD:319368 21/44 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.