DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and AIP2

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_197591.1 Gene:AIP2 / 832215 AraportID:AT5G20910 Length:310 Species:Arabidopsis thaliana


Alignment Length:157 Identity:57/157 - (36%)
Similarity:81/157 - (51%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDYFEELGHEPTGPLGANDLARNLKRLQVLAIMNGIDMEI----------EVPEASKRAILELP 55
            ||.:...:|.|.:.....|.:......:|.|  :||:||.|          ..|.|||..:.:||
plant   150 MSAFASIVGGESSNGPTENTIGETANLMQEL--INGLDMIIPDILDDGGPPRAPPASKEVVEKLP 212

  Fly    56 VHEIVKSDE-----GGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELE 115
            |  |:.::|     |.:.||.:|||....|.|.:.|||||.||..|:..||.:.||||:||:||.
plant   213 V--IIFTEELLKKFGAEAECCICKENLVIGDKMQELPCKHTFHPPCLKPWLDEHNSCPICRHELP 275

  Fly   116 TDDPVYEELR-RFRQDEANRRERENTL 141
            |||..||..: |.::.|..|:..||.:
plant   276 TDDQKYENWKEREKEAEEERKGAENAV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 21/41 (51%)
AIP2NP_197591.1 RING_Ubox 229..271 CDD:418438 21/41 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 1 1.000 - - otm2998
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3386
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.