DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and AT5G01980

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_195818.1 Gene:AT5G01980 / 831911 AraportID:AT5G01980 Length:493 Species:Arabidopsis thaliana


Alignment Length:127 Identity:45/127 - (35%)
Similarity:57/127 - (44%) Gaps:18/127 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDYFEELG-HEPTGPLGANDLARNLKRLQVLAIMNGIDMEIEVPEASKRAILELPVHEIVKSDE 64
            :.||.:|.| .|....|..:|.:|.                 ..|.||...:..||...|.:...
plant   297 VGDYLDERGFDELLEQLAESDNSRR-----------------GAPPASVSCVRNLPRVIIAEEHV 344

  Fly    65 GGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELETDDPVYEELRR 126
            ...|.|::|||......:...|||.|.:|..||:.||...||||||||||.|||..|||.:|
plant   345 MKGLVCAICKELFSLRNETTQLPCLHLYHAHCIVPWLSARNSCPLCRYELPTDDKDYEEGKR 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 18/41 (44%)
AT5G01980NP_195818.1 RING_Ubox 350..391 CDD:418438 18/40 (45%)
RING-H2 finger (C3H2C3-type) 350..390 CDD:319361 17/39 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.