DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and AT4G17245

DIOPT Version :10

Sequence 1:NP_650729.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_567525.1 Gene:AT4G17245 / 827437 AraportID:AT4G17245 Length:166 Species:Arabidopsis thaliana


Alignment Length:133 Identity:34/133 - (25%)
Similarity:50/133 - (37%) Gaps:40/133 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ANDLARNLKRLQVLAIMNGI-------------------------DMEIEVPEASKRAI----LE 53
            :||.|.|...|.::...:.|                         |:|...|:|....:    |.
plant    30 SNDFAANAFLLLIILFCSFICVLSLHAAIRCCLRPVLQHVPKPDPDLEATHPDAPPTLVYSPGLN 94

  Fly    54 LPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILP-CKHEFHEECILLWLKKT-NSCPLCRYELET 116
            |         .|.:.||.:|....::|...|:|. |||.||..||..||..: :|||.||..:.:
plant    95 L---------AGNEAECIICLSEFQDGDTLRVLERCKHGFHVYCIQKWLSSSHSSCPTCRTNIFS 150

  Fly   117 DDP 119
            ..|
plant   151 SPP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_650729.1 PEX10 <18..111 CDD:227861 31/123 (25%)
RING-H2_RNF181 69..114 CDD:438331 20/46 (43%)
AT4G17245NP_567525.1 RING_Ubox 101..145 CDD:473075 18/43 (42%)

Return to query results.
Submit another query.