DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7694 and AT3G60080

DIOPT Version :9

Sequence 1:	NP_001138076.1	Gene:	CG7694 / 42230	FlyBaseID:	FBgn0038627	Length:	147	Species:	Drosophila melanogaster
Sequence 2:	NP_191567.1	Gene:	AT3G60080 / 825178	AraportID:	AT3G60080	Length:	306	Species:	Arabidopsis thaliana

Alignment Length:	55	Identity:	29/55 - (52%)
Similarity:	35/55 - (63%)	Gaps:	0/55 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    62 SDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELET 116
            ||....|.|:||||....|:..|.|||.|.:|.:||:.||...|||||||:||.|
plant   161 SDPDSVLLCAVCKEDFIIGESARRLPCSHIYHSDCIVPWLSDHNSCPLCRFELPT 215

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7694	NP_001138076.1	zf-RING_2	69..111	CDD:290367	21/41 (51%)
AT3G60080	NP_191567.1	zinc_ribbon_9	18..57	CDD:405118
AT3G60080	NP_191567.1	RING-H2_RNF126_like	169..210	CDD:319581	21/40 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1249953at2759
OrthoFinder	1	1.000	-	-		FOG0000184
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.920