DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and AT3G02340

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001327209.1 Gene:AT3G02340 / 821090 AraportID:AT3G02340 Length:409 Species:Arabidopsis thaliana


Alignment Length:81 Identity:39/81 - (48%)
Similarity:53/81 - (65%) Gaps:3/81 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEASKRAILELPVHEIV--KSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNS 106
            |.|:|..|.:|||.|:.  :.|:|.:: |:|||:.....:|.|.|||.|.:|.|||:.||...|:
plant   308 PPAAKSVIQDLPVVELAVEELDKGNNV-CAVCKDEMLVEEKVRRLPCSHFYHGECIIPWLGIRNT 371

  Fly   107 CPLCRYELETDDPVYE 122
            ||:|||||.|||..||
plant   372 CPVCRYELPTDDLEYE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 19/41 (46%)
AT3G02340NP_001327209.1 RING-H2_RNF126_like 335..376 CDD:319581 19/40 (48%)
RING-H2 finger (C3H2C3-type) 335..375 CDD:319581 19/39 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 1 1.000 - - otm2998
orthoMCL 1 0.900 - - OOG6_105543
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3386
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.