powered by:
Protein Alignment CG7694 and AT2G44330
DIOPT Version :9
Sequence 1: | NP_001138076.1 |
Gene: | CG7694 / 42230 |
FlyBaseID: | FBgn0038627 |
Length: | 147 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_181961.1 |
Gene: | AT2G44330 / 819040 |
AraportID: | AT2G44330 |
Length: | 180 |
Species: | Arabidopsis thaliana |
Alignment Length: | 53 |
Identity: | 25/53 - (47%) |
Similarity: | 33/53 - (62%) |
Gaps: | 0/53 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 SDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYEL 114
|.:...|.|::|:|....|:..|.|||.|.:|.:||:.||...|||||||.||
plant 88 SSDDSALPCAICREDFVVGESARRLPCNHLYHNDCIIPWLTSHNSCPLCRVEL 140
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1249953at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000184 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.920 |
|
Return to query results.
Submit another query.