DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and RHC2A

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001318385.1 Gene:RHC2A / 818556 AraportID:AT2G39720 Length:401 Species:Arabidopsis thaliana


Alignment Length:81 Identity:37/81 - (45%)
Similarity:46/81 - (56%) Gaps:6/81 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EVPEASKRAILELPVHEI----VKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLK 102
            |.|.|||.||..||:.||    :.||  ....|:||||........|.:||.|.:|.:|||.||.
plant   171 EHPPASKSAIEALPLIEIDPTHLLSD--SQSHCAVCKENFVLKSSAREMPCNHIYHPDCILPWLA 233

  Fly   103 KTNSCPLCRYELETDD 118
            ..||||:||:||..:|
plant   234 IRNSCPVCRHELPAED 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 19/41 (46%)
RHC2ANP_001318385.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 1 1.000 - - otm2840
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15710
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.