DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and RHC2A

DIOPT Version :10

Sequence 1:NP_650729.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_030517.1 Gene:RHC2A / 818556 AraportID:AT2G39720 Length:401 Species:Arabidopsis thaliana


Alignment Length:81 Identity:37/81 - (45%)
Similarity:46/81 - (56%) Gaps:6/81 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EVPEASKRAILELPVHEI----VKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLK 102
            |.|.|||.||..||:.||    :.||  ....|:||||........|.:||.|.:|.:|||.||.
plant   171 EHPPASKSAIEALPLIEIDPTHLLSD--SQSHCAVCKENFVLKSSAREMPCNHIYHPDCILPWLA 233

  Fly   103 KTNSCPLCRYELETDD 118
            ..||||:||:||..:|
plant   234 IRNSCPVCRHELPAED 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_650729.1 PEX10 <18..111 CDD:227861 32/72 (44%)
RING-H2_RNF181 69..114 CDD:438331 21/44 (48%)
RHC2ANP_030517.1 zinc_ribbon_9 5..34 CDD:433910
RING_Ubox 201..242 CDD:473075 19/40 (48%)
DUF1117 273..>354 CDD:399509
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.