DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and AT2G28920

DIOPT Version :10

Sequence 1:NP_650729.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_180458.1 Gene:AT2G28920 / 817441 AraportID:AT2G28920 Length:145 Species:Arabidopsis thaliana


Alignment Length:55 Identity:20/55 - (36%)
Similarity:28/55 - (50%) Gaps:7/55 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EGGDLE------CSVCKEPAEEGQKYRIL-PCKHEFHEECILLWLKKTNSCPLCR 111
            :|||.:      |.:|.|..:.....|:| .|||.||.:||..|.....:||:||
plant    81 DGGDGDGVKADVCVICLEDFKVNDVVRVLVRCKHVFHVDCIDSWCFYKLTCPICR 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_650729.1 PEX10 <18..111 CDD:227861 18/53 (34%)
RING-H2_RNF181 69..114 CDD:438331 17/50 (34%)
AT2G28920NP_180458.1 RING_Ubox 92..135 CDD:473075 15/42 (36%)

Return to query results.
Submit another query.