powered by:
Protein Alignment CG7694 and RNF122
DIOPT Version :9
Sequence 1: | NP_001138076.1 |
Gene: | CG7694 / 42230 |
FlyBaseID: | FBgn0038627 |
Length: | 147 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_079063.2 |
Gene: | RNF122 / 79845 |
HGNCID: | 21147 |
Length: | 155 |
Species: | Homo sapiens |
Alignment Length: | 58 |
Identity: | 19/58 - (32%) |
Similarity: | 32/58 - (55%) |
Gaps: | 5/58 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 EIVKSDEGGDLE-----CSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLC 110
|:|...:...|: |:||.|..:...:..:|||:|.||.:|::.||:....||:|
Human 76 EVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMC 133
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.