DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and rnf115a

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001073542.1 Gene:rnf115a / 790928 ZFINID:ZDB-GENE-061215-82 Length:310 Species:Danio rerio


Alignment Length:75 Identity:31/75 - (41%)
Similarity:42/75 - (56%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEASKRAILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCP 108
            |.|.|..|..||...|.:.....::||.||||....|:..|.|||.|.||.:||:.||:..::||
Zfish   212 PPAEKEKISSLPTVIITQEHTDCNMECPVCKEDYTVGEPVRQLPCNHFFHSDCIVPWLELHDTCP 276

  Fly   109 LCRYELETDD 118
            :||..|..|:
Zfish   277 VCRKSLNGDE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 20/41 (49%)
rnf115aNP_001073542.1 zinc_ribbon_9 11..41 CDD:291067
zf-RING_2 237..279 CDD:290367 20/41 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.