DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and rnf32

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001070724.1 Gene:rnf32 / 768120 ZFINID:ZDB-GENE-061013-39 Length:363 Species:Danio rerio


Alignment Length:102 Identity:29/102 - (28%)
Similarity:45/102 - (44%) Gaps:27/102 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EVPEASKRAILELPVHEIVKSDEGGD--LECSVCKEPAEEGQKYRILP-----CKHEFHEECILL 99
            |..|...|:|||            ||  ..|::|:|      ::|:.|     |.|.||:.|:..
Zfish   103 EWAEVKTRSILE------------GDSTQPCAICRE------EFRLQPQVLLSCSHVFHKVCLKS 149

  Fly   100 WLKKTNS--CPLCRYELETDDPVYEELRRFRQDEANR 134
            :.|.:..  ||:||.|......:|:..|.:|:..|.|
Zfish   150 FEKFSGKKCCPMCRKEQYETRVIYDGARLYREKCALR 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 13/48 (27%)
rnf32NP_001070724.1 zf-rbx1 98..163 CDD:289448 21/77 (27%)
RING 121..165 CDD:238093 15/49 (31%)
zf-RING_2 287..340 CDD:290367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.