DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and Rnf126

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_653111.1 Gene:Rnf126 / 70294 MGIID:1917544 Length:313 Species:Mus musculus


Alignment Length:112 Identity:41/112 - (36%)
Similarity:57/112 - (50%) Gaps:7/112 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGHEPTGPLGANDL-----ARNLKRLQVLAIMNGIDMEIEVPEASKRAILELPVHEIVKSDEGGD 67
            ||..|.|.|.:|.:     |..|..: :..::|..: ....|.|.|..|..||...:.:...|..
Mouse   166 LGLGPWGVLHSNPMDYAWGANGLDTI-ITQLLNQFE-NTGPPPADKEKIQALPTVPVTEEHVGSG 228

  Fly    68 LECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYEL 114
            |||.||||....|:..|.|||.|.||:.||:.||::.:|||:||..|
Mouse   229 LECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 21/41 (51%)
Rnf126NP_653111.1 Required for interaction with BAG6. /evidence=ECO:0000250|UniProtKB:Q9BV68 5..100
zinc_ribbon_9 10..40 CDD:373030
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..63
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..128
Sufficient for interaction with AICDA. /evidence=ECO:0000250|UniProtKB:Q9BV68 202..306 32/74 (43%)
RING-H2_RNF126 230..273 CDD:319715 22/42 (52%)
RING-H2 finger (C3H2C3-type) 231..271 CDD:319715 20/39 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.