DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and RNF181

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_005264416.1 Gene:RNF181 / 51255 HGNCID:28037 Length:187 Species:Homo sapiens


Alignment Length:153 Identity:30/153 - (19%)
Similarity:58/153 - (37%) Gaps:39/153 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDYFEELGHEPTGPLGAN------DLARNL-KRLQVLAIMNGIDMEIEVPEASKRAILELPVHE 58
            |:.||:|...||:.|....      :|||:| .|:....:...:|.:..:|..:.:.::|.....
Human     1 MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRT 65

  Fly    59 IVKSDEGG-------------DLECSVCKEP----AEEG--QKYRILP-CKH------EFHEECI 97
            :::..:..             .::|...:|.    |.||  |..:|.| .:|      :....|.
Human    66 VIRGSQAALTVPWAQYSSFFLFMDCWGMEEEWQLGAGEGGYQLMKIRPRLEHYSTFLRQIPVPCA 130

  Fly    98 LLWLKKTNSCPLCRYELETDDPV 120
            .:      ||||....:.:.|.:
Human   131 AM------SCPLMTTLMRSTDEI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 14/54 (26%)
RNF181XP_005264416.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159842
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BPM3
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I5066
Isobase 1 0.950 - 0 Normalized mean entropy S2782
OMA 1 1.010 - - QHG48963
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 1 1.000 - - oto90665
orthoMCL 1 0.900 - - OOG6_105543
Panther 1 1.100 - - LDO PTHR15710
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1776
SonicParanoid 1 1.000 - - X3386
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.