DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and rnf181

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001011200.1 Gene:rnf181 / 496625 XenbaseID:XB-GENE-964051 Length:156 Species:Xenopus tropicalis


Alignment Length:166 Identity:61/166 - (36%)
Similarity:89/166 - (53%) Gaps:31/166 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDYFEELGHEPTGP------LGANDLARNLKRLQVLAIMNGIDMEIEV-----------PEASK 48
            |:.||:|...|||.|      ....:|||:|        ::|:|:::..           |.|:|
 Frog     1 MASYFDEHNCEPTVPEEQYRQNALLELARSL--------LSGMDIDLGALDFTEWDQRLPPPAAK 57

  Fly    49 RAILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYE 113
            :.:..||...:........|:|.||....|||:..|.|||:|.||..|||.||.|||||||||:|
 Frog    58 KVVESLPKVTVTPEQADAALKCPVCLLEFEEGETVRQLPCEHLFHSSCILPWLGKTNSCPLCRHE 122

  Fly   114 LETDDPVYEELRRFRQDEANRREREN---TLLDSMF 146
            |.||.|.|||   ::|::..|:::|:   .|.|:|:
 Frog   123 LPTDSPEYEE---YKQEKERRQQKEHRLECLHDAMY 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 25/41 (61%)
rnf181NP_001011200.1 PEX10 <10..126 CDD:227861 45/123 (37%)
RING-H2_RNF181 78..123 CDD:319583 27/44 (61%)
RING-H2 finger (C3H2C3-type) 79..119 CDD:319583 24/39 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9980
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I4809
OMA 1 1.010 - - QHG48963
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 1 1.000 - - otm48938
Panther 1 1.100 - - LDO PTHR15710
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1776
SonicParanoid 1 1.000 - - X3386
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.