DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and ARK2C

DIOPT Version :10

Sequence 1:NP_650729.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_689683.2 Gene:ARK2C / 494470 HGNCID:31696 Length:346 Species:Homo sapiens


Alignment Length:116 Identity:38/116 - (32%)
Similarity:54/116 - (46%) Gaps:18/116 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FEELGHEPTGPLGANDLARNLKRLQVLAIMNGIDMEIEVPEASKRAILELPVHEIVKSDEG---- 65
            :|||       |...|...|:.|   .|:.|.|: ....|...|:   ..|.....|.|||    
Human   239 YEEL-------LQLEDRLGNVTR---GAVQNTIE-RFTFPHKYKK---RRPQDGKGKKDEGEESD 289

  Fly    66 GDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELET 116
            .|.:|::|....|:|:..|.|||.|.||:.|:..||..:..||:||.::||
Human   290 TDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDIET 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_650729.1 PEX10 <18..111 CDD:227861 30/96 (31%)
RING-H2_RNF181 69..114 CDD:438331 18/44 (41%)
ARK2CNP_689683.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..76
Ubiquitin binding. /evidence=ECO:0000269|PubMed:26656854, ECO:0007744|PDB:5D0K 266..268 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..288 7/23 (30%)
RING-H2_RNF165 285..343 CDD:438344 22/56 (39%)
Ubiquitin binding. /evidence=ECO:0000269|PubMed:26656854, ECO:0007744|PDB:5D0K 309..313 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.