DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and Rnf150

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001178022.1 Gene:Rnf150 / 364983 RGDID:1304572 Length:437 Species:Rattus norvegicus


Alignment Length:100 Identity:33/100 - (33%)
Similarity:50/100 - (50%) Gaps:18/100 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ANDLARNLKRLQVLAIMNGIDMEIEVPEASKRAILELPVHEIVKSDEGGDLE---CSVCKEPAEE 79
            ||...||.:||               .:|:|:||.:|.|..|.|.|:..:.:   |:||.|..:.
  Rat   237 ANARDRNQRRL---------------GDAAKKAISKLQVRTIRKGDKETESDFDNCAVCIEGYKP 286

  Fly    80 GQKYRILPCKHEFHEECILLWLKKTNSCPLCRYEL 114
            ....|||||:|.||:.|:..||....:||:|:..:
  Rat   287 SDVVRILPCRHLFHKSCVDPWLLDHRTCPMCKMNI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 17/44 (39%)
Rnf150NP_001178022.1 PA_GRAIL_like 45..192 CDD:239037
UPF0233 <206..>231 CDD:299753
zf-RING_2 275..318 CDD:290367 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.