DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and Rnf181

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001007648.1 Gene:Rnf181 / 297337 RGDID:1359698 Length:165 Species:Rattus norvegicus


Alignment Length:163 Identity:55/163 - (33%)
Similarity:83/163 - (50%) Gaps:29/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDYFEELGHEPTGPLGANDLARNLKRLQVLAIMNG----------------------IDMEIEV 43
            |:.||:|...||..|   ...|||...|::...:.|                      :|.|..:
  Rat     1 MASYFDEHDCEPLNP---EREARNNMLLELARRVRGAWSWAPGSRSLFNRMDFEDLGLVDWEHHL 62

  Fly    44 PEASKRAILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCP 108
            |..:.:|::|.....:::|.: .:|:|.||....||.:....:||.|.||..|||.||.||||||
  Rat    63 PPPAAKAVVESLPRTVIRSSK-AELKCPVCLLEFEEEETVIEMPCHHLFHSNCILPWLSKTNSCP 126

  Fly   109 LCRYELETDDPVYEELRRFRQDEANRRERENTL 141
            |||:||.|||..|||   .::|:|.|:::::.|
  Rat   127 LCRHELPTDDDSYEE---HKKDKARRQQQQHRL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 22/41 (54%)
Rnf181NP_001007648.1 RING-H2_RNF181 87..132 CDD:319583 24/44 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..165 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BPM3
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5022
OMA 1 1.010 - - QHG48963
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 1 1.000 - - oto97774
orthoMCL 1 0.900 - - OOG6_105543
Panther 1 1.100 - - LDO PTHR15710
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3386
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.