powered by:
Protein Alignment CG7694 and RNF149
DIOPT Version :9
Sequence 1: | NP_001138076.1 |
Gene: | CG7694 / 42230 |
FlyBaseID: | FBgn0038627 |
Length: | 147 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005263977.1 |
Gene: | RNF149 / 284996 |
HGNCID: | 23137 |
Length: | 428 |
Species: | Homo sapiens |
Alignment Length: | 71 |
Identity: | 26/71 - (36%) |
Similarity: | 42/71 - (59%) |
Gaps: | 3/71 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 SKRAILELPVHEIVKSDEGGDLE---CSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCP 108
:|:.|.:|.:|.:...::|.|:: |:||.|..:.....|||||||.||..||..||....:||
Human 243 TKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWLLDHRTCP 307
Fly 109 LCRYEL 114
:|:.::
Human 308 MCKLDV 313
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.