DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and AT3G10815

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_974274.1 Gene:AT3G10815 / 2745878 AraportID:AT3G10815 Length:199 Species:Arabidopsis thaliana


Alignment Length:113 Identity:42/113 - (37%)
Similarity:51/113 - (45%) Gaps:22/113 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FEELGHEPTGPLGANDLARNLKRLQVLAIMNGIDMEIEVPEASKRAILELPVHEIVKSDEGGDLE 69
            ||||                ..||..|....|      .|.||..||..|...:|.:...|.|..
plant    78 FEEL----------------FNRLPALQDRRG------PPPASLAAINSLQKIKIRQKHLGLDPY 120

  Fly    70 CSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELETD 117
            |.||::..|.|...|.:||||.:|.||||.||.:.|:||:||.||..|
plant   121 CPVCQDQFEIGSDARKMPCKHIYHSECILPWLVQRNTCPVCRKELPQD 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 20/41 (49%)
AT3G10815NP_974274.1 zinc_ribbon_9 8..42 CDD:405118
COG5540 <75..166 CDD:227827 40/109 (37%)
RING_Ubox 121..162 CDD:418438 20/40 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.