DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and RNF115

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_055270.1 Gene:RNF115 / 27246 HGNCID:18154 Length:304 Species:Homo sapiens


Alignment Length:103 Identity:37/103 - (35%)
Similarity:51/103 - (49%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEASKRAILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCP 108
            |.|.|..|..||...:.:......|||.||||.....::.|.|||.|.||..||:.||:..::||
Human   202 PPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCP 266

  Fly   109 LCRYELETDDPVYEELRRFRQDEA---NRRERENTLLD 143
            :||..|..:|    ..|:.:..||   ||...::.|.|
Human   267 VCRKSLNGED----STRQSQSTEASASNRFSNDSQLHD 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 19/41 (46%)
RNF115NP_055270.1 zinc_ribbon_9 19..49 CDD:316857
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..138
RING-H2_RNF115 226..272 CDD:319714 22/45 (49%)
RING-H2 finger (C3H2C3-type) 228..268 CDD:319714 18/39 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..304 9/33 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.