DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and RNF11

DIOPT Version :10

Sequence 1:NP_650729.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_055187.1 Gene:RNF11 / 26994 HGNCID:10056 Length:154 Species:Homo sapiens


Alignment Length:54 Identity:20/54 - (37%)
Similarity:26/54 - (48%) Gaps:6/54 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DEGGD------LECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLC 110
            |.|.|      .||.:|......|...|.|||.|.:|.:||..||.::.:||.|
Human    86 DPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSC 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_650729.1 PEX10 <18..111 CDD:227861 20/54 (37%)
RING-H2_RNF181 69..114 CDD:438331 17/42 (40%)
RNF11NP_055187.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
PPxY motif 37..40
RING-H2_RNF11 98..140 CDD:438131 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.